PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G13590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 850aa    MW: 93821.1 Da    PI: 6.9041
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G13590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.96.6e-52101391129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yLkkkv  +k++l evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk 
  OGLUM04G13590.1  10 VPPGFRFHPTDEELLLYYLKKKVGFEKFDL-EVIREVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKC 102
                      69****************************.99**************963433332566*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  OGLUM04G13590.1 103 IRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 139
                      **9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-595161IPR003441NAC domain
PROSITE profilePS510055810161IPR003441NAC domain
PfamPF023658.3E-2711138IPR003441NAC domain
PfamPF085835.8E-8377428IPR013892Cytochrome c oxidase biogenesis protein Cmc1-like
Gene3DG3DSA:3.20.20.704.0E-126473842IPR013785Aldolase-type TIM barrel
CDDcd029333.94E-166479820No hitNo description
SuperFamilySSF513958.18E-108479839No hitNo description
PfamPF007247.3E-77480816IPR001155NADH:flavin oxidoreductase/NADH oxidase, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0010181Molecular FunctionFMN binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KVGFEKFDLE VIREVDLNKI EPWELQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKTD WIMHEYRLED ADDSQSASSE DGWVVCRVFK KKCFFKIGGG GGGEGSGGSQ  180
GGDVGGGHLA VSPPLGGGHA MAAASHYMHP HHQYHHHHHH AAAASPFYYT QMPPPAAAAP  240
PHAAYSHHVQ VQDLLTNHRP SADAGYDFSG LPAVDHHHHH PGLDVGSSDG GGGVAAGGAD  300
GDQAAAAAAG STDQQQWQAM DGFSNGGAGA AAAVQQQLGA MSSGQRGGEM DLWGYGRLTF  360
YIFGNASPSN LTQASYIIEA FQKCHVDHPV KKFFGECTDL KIKLDQCFRQ EKALKRKANF  420
EESKKFKEHT VGSPIADIDC KSCSRNKDNY VICPFKFQVN QDTRTSRGAG EREKMDPVPL  480
FNPCEMGRFT FSHRIVLAPL TRARSYGNLP QSHAILYYSQ RATKGGLLIS EATGVSSDAP  540
CTNTPGIWTK EQVEAWKPVV DAVHAKGGIF FCQIWHVGRA SDLEQEPISS TDKPVEKNED  600
MDFPVPRRLA VEEIPDVINH FRIAARNAID AGFDGVEVHG AHGFLLEQFM KDGVNDRADE  660
YGGSLQNRCR FALEVIDAVS TEVGPDRVGF RISPYISYYG CHDSDPDALG VYMARELDRR  720
GVLYCSAVEP EMVAATTVVD GETTTTTMSR RMMIPHRLHG MREAFRRGMF MVGGGYDRDA  780
GNMAVASGYA DMVVFGRLFL ANPDLPRRFQ LDAPLNKYDR ATFYTHDPVV GYTDYPFLDD  840
DREAMSDHTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vji_A1e-156473839536912-oxophytodienoate reductase (OPR1)
2q3r_A1e-156473839536912-oxophytodienoate reductase 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0672180.0AK067218.1 Oryza sativa Japonica Group cDNA clone:J013098J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9ZL910.0A0A0D9ZL91_9ORYZ; Uncharacterized protein
STRINGBGIOSGA015018-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.18e-76NAC domain containing protein 70